Fpr2 Protein, Mouse (Cell-Free, His)
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
O88536 (M1-P351)
-
Gene ID2358
-
Molecular Construction
-
N-term
-
10*His
-
Fpr2 (M1-P351)
Accession # O88536 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FPR2; FPRH2; Prev. FPRL1; FPR2A; Formyl Peptide Receptor-Like 1; ALXR; N-Formyl Peptide Receptor 2; Lipoxin A4 Receptor; LXA4R; LXA4 Receptor; HM63; FMLP-R-I; ALX; FPRH1; FMLP-Related Receptor I; RFP; FMLP-R-II; Lipoxin A4 Receptor (Formyl Peptide Recepto
-
AA Sequence
MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
-
Predicted Molecular Mass
40.9 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE .
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
