Frizzled-6 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Frizzled-6 is a Wnt receptor that complexly activates signaling pathways that converge primarily on the β-catenin canonical pathway. This triggers disorganized protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-6 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Frizzled-6 is a Wnt receptor that complexly activates signaling pathways that converge primarily on the β-catenin canonical pathway. This triggers disorganized protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-6 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-6 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-6, a receptor for Wnt proteins, is intricately involved in signaling pathways that predominantly converge on the beta-catenin canonical pathway. This cascade triggers the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. While a secondary signaling pathway implicating PKC and calcium fluxes has been observed in some family members, its precise relationship with the canonical pathway remains unclear, and the requirement of PKC for Wnt-mediated inactivation of GSK-3 kinase adds complexity to this interplay. Interactions with G-proteins are integral to both pathways. Frizzled-6 is positioned to play a pivotal role in transducing polarity information during tissue morphogenesis and in differentiated tissues. Teaming up with FZD3, it contributes to neural tube closure and regulates the establishment of planar cell polarity, especially in orienting asymmetric bundles of stereocilia on the apical faces of select auditory and vestibular sensory cells within the inner ear. Its functional repertoire is further underscored by interactions with LMBR1L.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-6, at 0.1μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 125.3 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-6, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 125.3 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Frizzled-6 (H19-V153)
      Accession # O60353/NP_003497.2
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD6; Frizzled Homolog 6 (Drosophila); Frizzled Class Receptor 6; Frizzled Homolog 6; Frizzled-6; NDNC10; Hfz6; NDNC1; Frizzled 6, Seven Transmembrane Spanning Receptor; FZ-6; Frizzled Family Receptor 6; HFz6; Seven Transmembrane Helix Receptor; Fz-6; Fri

  • AA Sequence

    HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQV

  • Molecular Weight

    Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00