FUS Protein, Human (His, Myc)
Based on 1 Customer Validation
FUS Protein, Human (His, Myc) is the recombinant human-derived FUS, expressed by E. coli , with N-10*His, C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FUS Protein, Human (His, Myc) is the recombinant human-derived FUS, expressed by E. coli , with N-10*His, C-Myc labeled tag.
Background
TLS/FUS is a DNA/RNA-binding protein involved in multiple cellular processes including transcription regulation, RNA splicing, RNA transport, DNA repair, and damage response. It specifically binds single-stranded RNA containing the 5'-AGGUAA-3' consensus sequence and interacts with nascent pre-mRNAs, serving as a molecular bridge between RNA polymerase II and U1 small nuclear ribonucleoprotein to couple transcription with splicing. The protein autoregulates its expression by binding its own pre-mRNA via nonsense-mediated decay. During DNA double-strand break repair, it promotes D-loop formation and homologous recombination. In neuronal cells (by similar), it plays essential roles in dendritic spine formation/stability, RNA transport, mRNA stability, and synaptic homeostasis.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized FUS at 1 μg/mL (100 μL/well) can bind FUS antibody, The ED50 for this effect is 2.991 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P35637-1 (M1-Y526)
-
Gene ID2521
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FUS; Oncogene TLS; Prev. ALS6; AltFUS; TLS; Fusion (Involved In T(12; 16) In Malignant Liposarcoma); RNA-Binding Protein FUS; Fusion, Derived From T(12; 16) Malignant Liposarcoma; HNRNPP2; Fusion Gene In Myxoid Liposarcoma; FUS1; Amyotrophic Lateral Scleros
-
AA Sequence
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
-
Molecular Weight
Approximately 68-70 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
