Galectin-4 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Galectin-4 is a lactose-binding protein belonging to the galectin family that exhibits specific affinities for a range of structurally related sugars. This multifunctional protein is noteworthy for its functionality as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as part of a larger complex. Galectin-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-4 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Galectin-4 is a lactose-binding protein belonging to the galectin family that exhibits specific affinities for a range of structurally related sugars. This multifunctional protein is noteworthy for its functionality as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as part of a larger complex. Galectin-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-4 protein, expressed by HEK293 , with N-His labeled tag.
Background
Galectin-4 is a lactose-binding protein belonging to the galectin family, and it exhibits a specific affinity for a range of sugars that are structurally related. This versatile protein is noteworthy for functioning as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as a part of a larger complex.
Verified Bioactivity
Measured in a cytotoxicity assay using HT-29 cells. The ED50 for this effect is 529.2 ng/mL, corresponding to a specific activity is 1889.645 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
Q8K419 (M1-I326)
-
Molecular Construction
-
N-term
-
His
-
Galectin-4 (M1-I326)
Accession # Q8K419 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALS4; Antigen NY-CO-27; Galectin 4; Galectin-4; GAL4; L36LBP; Lectin, Galactoside-Binding, Soluble, 4; Gal-4; L-36 Lactose-Binding Protein; Galectin; Lactose-Binding Lectin 4
-
AA Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
-
Predicted Molecular Mass
36.4 kDa
-
Molecular Weight
Approximately 37-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.4, 0.1% Brij-35, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)