Copy Link Print Information

Galectin-4 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Galectin-4 is a lactose-binding protein belonging to the galectin family that exhibits specific affinities for a range of structurally related sugars. This multifunctional protein is noteworthy for its functionality as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as part of a larger complex. Galectin-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-4 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Galectin-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Galectin-4 Protein, Mouse (HEK293, His)
  • Galectin-4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Galectin-4 is a lactose-binding protein belonging to the galectin family that exhibits specific affinities for a range of structurally related sugars. This multifunctional protein is noteworthy for its functionality as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as part of a larger complex. Galectin-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-4 protein, expressed by HEK293 , with N-His labeled tag.

Background

Galectin-4 is a lactose-binding protein belonging to the galectin family, and it exhibits a specific affinity for a range of sugars that are structurally related. This versatile protein is noteworthy for functioning as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as a part of a larger complex.

Verified Bioactivity

Measured in a cytotoxicity assay using HT-29 cells. The ED50 for this effect is 529.2 ng/mL, corresponding to a specific activity is 1889.645 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-His
  • Accession

    Q8K419 (M1-I326)

  • Gene ID
    16855  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • Galectin-4 (M1-I326)
      Accession # Q8K419
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    LGALS4; Antigen NY-CO-27; Galectin 4; Galectin-4; GAL4; L36LBP; Lectin, Galactoside-Binding, Soluble, 4; Gal-4; L-36 Lactose-Binding Protein; Galectin; Lactose-Binding Lectin 4

  • AA Sequence

    MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

  • Predicted Molecular Mass

    36.4 kDa

  • Molecular Weight

    Approximately 37-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.4, 0.1% Brij-35, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cytotoxicity assay using HT-29 cells. The ED50 for this effect is 529.2 ng/mL, corresponding to a specific activity is 1889.645 units/mg.

  • Galectin-4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Galectin-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Galectin-4 Protein, Mouse (HEK293, His)
  • Galectin-4 Protein, Mouse (HEK293, His) Product Image