Galectin-4 Protein, Mouse (HEK293, His)

Galectin-4 is a lactose-binding protein belonging to the galectin family that exhibits specific affinities for a range of structurally related sugars. This multifunctional protein is noteworthy for its functionality as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as part of a larger complex. Galectin-4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-4 protein, expressed by HEK293 , with N-His labeled tag.

Galectin-4 is a lactose-binding protein belonging to the galectin family, and it exhibits a specific affinity for a range of sugars that are structurally related. This versatile protein is noteworthy for functioning as a monomer, highlighting its individual molecular structure and suggesting that it may exert its biological effects through independent interactions rather than as a part of a larger complex.

Measured in a cytotoxicity assay using HT-29 cells. The ED₅₀ for this effect is 529.2 ng/mL, corresponding to a specific activity is 1889.645 units/mg.

• 
  Measured in a cytotoxicity assay using HT-29 cells. The ED₅₀ for this effect is 529.2 ng/mL, corresponding to a specific activity is 1889.645 units/mg.

Mouse

HEK293

N-His

Q8K419 (M1-I326)

16855  [NCBI]

Full Length

MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

37-48 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.4, 0.1% Brij-35, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.