1. Recombinant Proteins
  2. Others
  3. GCAP1 Protein, Human (sf9, His-GST)

The GCAP1 protein is a key regulator in the visual system, regulating retinal guanylyl cyclase activity in response to intracellular calcium concentration. Under low calcium conditions, GCAP1 stimulates retinal guanylyl cyclase to return rod photoreceptors to the dark state. GCAP1 Protein, Human (sf9, His-GST) is the recombinant human-derived GCAP1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GCAP1 protein is a key regulator in the visual system, regulating retinal guanylyl cyclase activity in response to intracellular calcium concentration. Under low calcium conditions, GCAP1 stimulates retinal guanylyl cyclase to return rod photoreceptors to the dark state. GCAP1 Protein, Human (sf9, His-GST) is the recombinant human-derived GCAP1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

GCAP1 protein serves as a pivotal regulator in the visual system, exhibiting a dual role in modulating retinal guanylyl cyclase activity based on intracellular calcium concentrations. Under low free calcium ion conditions, GCAP1 stimulates retinal guanylyl cyclase, facilitating the recovery of the dark state in rod photoreceptors after exposure to light. Conversely, when the concentration of free calcium ions is elevated, GCAP1 inhibits guanylyl cyclase activity. This calcium-sensitive control mechanism represents a crucial aspect of the phototransduction process in rod photoreceptors. Additionally, GCAP1 may play a role in the light response and recovery of cone photoreceptors in bright light conditions. The protein functions as a homodimer, further contributing to its regulatory capabilities in the visual signaling pathway.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P43080 (M1-G201)

Gene ID
Molecular Construction
N-term
His-GST
GCAP1 (M1-G201)
Accession # P43080
C-term
Protein Length

Full Length

Synonyms
Guanylyl cyclase-activating protein 1; Guanylate cyclase activator 1A; C6orf131; GCAP; GUCA1; GUCA1A
AA Sequence

MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

Predicted Molecular Mass
50.7 kDa
Molecular Weight

Approximately 42 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GCAP1 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GCAP1 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GCAP1 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76945
Quantity:
MCE Japan Authorized Agent: