GCAP1 Protein, Human (sf9, His-GST)
The GCAP1 protein is a key regulator in the visual system, regulating retinal guanylyl cyclase activity in response to intracellular calcium concentration. Under low calcium conditions, GCAP1 stimulates retinal guanylyl cyclase to return rod photoreceptors to the dark state. GCAP1 Protein, Human (sf9, His-GST) is the recombinant human-derived GCAP1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GCAP1 protein is a key regulator in the visual system, regulating retinal guanylyl cyclase activity in response to intracellular calcium concentration. Under low calcium conditions, GCAP1 stimulates retinal guanylyl cyclase to return rod photoreceptors to the dark state. GCAP1 Protein, Human (sf9, His-GST) is the recombinant human-derived GCAP1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
GCAP1 protein serves as a pivotal regulator in the visual system, exhibiting a dual role in modulating retinal guanylyl cyclase activity based on intracellular calcium concentrations. Under low free calcium ion conditions, GCAP1 stimulates retinal guanylyl cyclase, facilitating the recovery of the dark state in rod photoreceptors after exposure to light. Conversely, when the concentration of free calcium ions is elevated, GCAP1 inhibits guanylyl cyclase activity. This calcium-sensitive control mechanism represents a crucial aspect of the phototransduction process in rod photoreceptors. Additionally, GCAP1 may play a role in the light response and recovery of cone photoreceptors in bright light conditions. The protein functions as a homodimer, further contributing to its regulatory capabilities in the visual signaling pathway.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P43080 (M1-G201)
-
Molecular Construction
-
N-term
-
His-GST
-
GCAP1 (M1-G201)
Accession # P43080 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GUCA1A; GCAP-1; Prev. C6orf131; Cone Dystrophy 3; Prev. GUCA1; DJ139D8.6; Prev. GUCA; Guanylate Cyclase-Activating Protein, Photoreceptor 1; GCAP1; Guanylate Cyclase Activator 1A (Retina); GCAP; Chromosome 6 Open Reading Frame 131; Guanylyl Cyclase-Activa
-
AA Sequence
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
-
Predicted Molecular Mass
50.7 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
