GCGR Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, hFc) is the recombinant human-derived GCGR protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, hFc) is the recombinant human-derived GCGR protein, expressed by HEK293, with C-hFc labeled tag.
Background
The GCGR Protein serves as a G-protein coupled receptor for glucagon, playing a pivotal role in the regulation of blood glucose levels and glucose homeostasis. It actively regulates hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, making it a key mediator of responses to fasting. Upon ligand binding, the receptor undergoes a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins), subsequently modulating downstream effectors such as adenylate cyclase. This modulation results in the activation of adenylate cyclase. Furthermore, the receptor contributes to signaling via a phosphatidylinositol-calcium second messenger system, underscoring its multifaceted role in glucose regulation.
Verified Bioactivity
Immobilized Human GCGR, hFc Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Anti-GCGR Antibody, hFc Avi Tag with the EC50 of 14.7 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P47871 (A26-K136)
-
Gene ID2642
-
Molecular Construction
-
N-term
-
GCGR (Ala26-Lys136)
Accession # P47871 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GCGR; GL-R; Glucagon Receptor; MVAH; GGR
-
AA Sequence
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
-
Predicted Molecular Mass
39 kDa
-
Molecular Weight
Approximately 52-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
