GCGR Protein, Human (HEK293, His, Avi)

The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, His, Avi) is the recombinant human-derived GCGR protein, expressed by HEK293, with C-Avi and C-His labeled tag.

The GCGR Protein serves as a G-protein coupled receptor for glucagon, playing a pivotal role in the regulation of blood glucose levels and glucose homeostasis. It actively regulates hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, making it a key mediator of responses to fasting. Upon ligand binding, the receptor undergoes a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins), subsequently modulating downstream effectors such as adenylate cyclase. This modulation results in the activation of adenylate cyclase. Furthermore, the receptor contributes to signaling via a phosphatidylinositol-calcium second messenger system, underscoring its multifaceted role in glucose regulation.

Human

HEK293

C-Avi;C-8*His

P47871 (A26-K136)

2642

Extracellular Domain

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.