GFER Protein, Human (HEK293, His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (HEK293, His) is the recombinant human-derived GFER protein, expressed by HEK293 , with C-His labeled tag.

GFER protein functions as an autocrine hepatotrophic growth factor that plays a critical role in promoting liver regeneration.

Measured by its ability to inhibit chemoattract of HepG2 cells. 3 μg/mL Recombinant GFER can effectively inhibit the chemotaxis of HepG2 cells.

• 
  Measured by its ability to inhibit chemoattract of HepG2 Human liver cancer cells. 3 μg/mL Human GFER can effectively inhibit the chemotaxis of HepG2 cells.

Human

HEK293

C-6*His

P55789-2 (M1-D125)

2671

Full Length of Isoform-2

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Approximately 16 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.