GJA1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The GJA1 protein regulates bladder capacity through gap junctions, clusters of transmembrane channels that allow the diffusion of low molecular weight materials between adjacent cells. GJA1 protein also regulates NOV expression and localization and is important for ventricular gap junction communication. GJA1 Protein, Human (His) is the recombinant human-derived GJA1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The GJA1 Protein serves as a gap junction protein with regulatory roles in bladder capacity. Comprising closely packed pairs of transmembrane channels called connexons, it facilitates the diffusion of low molecular weight materials between neighboring cells. This protein plays a crucial role in hearing physiology by participating in the recycling of potassium to the cochlear endolymph. Acting as a negative regulator of bladder functional capacity, GJA1 enhances intercellular electrical and chemical transmission, sensitizing bladder muscles to cholinergic neural stimuli and causing contraction. Additionally, it may contribute to cell growth inhibition through the regulation of NOV expression and localization. Essential for gap junction communication in the ventricles, GJA1 interacts with various proteins, including TJP1, SRC, UBQLN4, SGSM3, CNST, RIC1/CIP150, CSNK1D, NOV, and TMEM65, thereby playing a multifaceted role in cellular communication and regulation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • GJA1 (F233-I382)
      Accession # P17302
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    GJA1; Oculodentodigital Dysplasia (Syndactyly Type III); Prev. GJAL; Gap Junction Protein; Prev. ODDD; Connexin 43; CX43; AVSD3; Gap Junction Protein, Alpha 1, 43kDa; EKVP3; Gap Junction 43 KDa Heart Protein; HLHS1; Gap Junction Alpha-1 Protein; PPKCA; Co

  • AA Sequence

    FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

  • Predicted Molecular Mass

    20.3 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00