1. Recombinant Proteins
  2. Others
  3. GM-CSF Protein, Pig

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Pig is the recombinant Porcine-derived GM-CSF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. GM-CSF Protein, Pig is the recombinant Porcine-derived GM-CSF protein, expressed by E. coli , with tag free.

Background

GM-CSF Protein serves as a potent cytokine, orchestrating the growth and differentiation of hematopoietic precursor cells across diverse lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer, and its signaling is mediated through a dodecameric complex. This complex comprises two head-to-head hexamers, each featuring two alpha, two beta, and two ligand subunits, underscoring the intricacy of the receptor assembly and the specificity of GM-CSF in modulating cellular responses.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 8.771 ng/mL, corresponding to a specific activity is 1.14×105 U/mg.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 8.771 ng/mL, corresponding to a specific activity is 1.14×105 U/mg.
Species

Porcine

Source

E. coli

Tag

Tag Free

Accession

Q29118 (A18-K144)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-K144)
Accession # Q29118
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Granulocyte-macrophage colony-stimulating factor; CSF2; GM-CSF; Colony-stimulating factor; CSF; Granulocyte Macrophage Growth Factor
AA Sequence

APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

Predicted Molecular Mass
14.4 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GM-CSF Protein, Pig Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GM-CSF Protein, Pig

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Pig
Cat. No.:
HY-P79256
Quantity:
MCE Japan Authorized Agent: