1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 beta
  6. GMP IL-1 beta Protein, Human

GMP IL-1 beta Protein, Human

Cat. No.: HY-P70586G
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $600 In-stock
Estimated Time of Arrival: December 31
500 μg $2100 Get quote
1 mg $3000 Get quote

* Please select Quantity before adding items.

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
The specific activity is > 1×107 U/mg.
Species

Human; Mouse

Source

E. coli

Tag

Tag Free

Accession

P01584 (A117-S269)

Gene ID
Synonyms
Interleukin-1 beta; Catabolin; IL1F2; IL1B
AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 7.5.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP IL-1 beta Protein, Human
Cat. No.:
HY-P70586G
Quantity:
MCE Japan Authorized Agent: