GMP IL-6 Protein, Human
Based on 2 publication(s) in Google Scholar
IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. GMP IL-6 Protein, Human is the recombinant human-derived IL-6 protein, expressed by E. coli , with tag free. GMP IL-6 Protein, Human, has molecular weight of ~20.0 kDa.
Background
GMP IL-6 Protein, a versatile cytokine, performs various biological functions in immunity, tissue regeneration, and metabolism. Upon binding to IL6R, the resulting complex associates with the signaling subunit IL6ST/gp130, triggering the intracellular IL6-signaling pathway. Its interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling,' while the binding of IL6 and soluble IL6R to IL6ST induces 'trans-signaling.' Moreover, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 serves as a potent inducer of the acute phase response, rapidly mobilizing host defenses during infection and tissue injury, although excessive IL6 synthesis is implicated in disease pathology. In the innate immune response, IL-6 is synthesized by myeloid cells, such as macrophages and dendritic cells, upon recognizing pathogens through toll-like receptors at the infection or tissue injury site. In the adaptive immune response, IL-6 is essential for B-cell differentiation into immunoglobulin-secreting cells and plays a major role in the differentiation of CD4(+) T cell subsets. It is a crucial factor in the development of T follicular helper (Tfh) cells necessary for germinal-center formation and is required to drive naive CD4(+) T cells to the Th17 lineage. Additionally, IL-6 is essential for the proliferation of myeloma cells and the survival of plasmablast cells.
Verified Bioactivity
The specific activity is > 2×107 U/mg.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cell Rep
Liquidambaric acid inhibits Wnt/β-catenin signaling and colon cancer via targeting TNF receptor-associated factor 2. [Abstract]2022 Feb 1;38(5):110319. PMID: 35108540 -
J Cell Mol Med
17-β-Estradiol Protects Chondrocytes From Senescence and Ameliorates Osteoarthritis Progression via ERα-AKT-FOXO4 Pathway. [Abstract]2026 Feb;30(3):e71018. PMID: 41677002
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P05231 (V30-M212)
-
Molecular Construction
-
N-term
-
IL-6
Accession # P05231 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ
-
AA Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
-
Predicted Molecular Mass
20.9 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or 20mM PB, 5% Sucrose, 4% Mannitol, 0.05% Tween-80, pH7.4.
<0.05 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)