GNA14 Protein, Human (GST)
GNA14 Protein, Human (GST) is the recombinant human-derived GNA14, expressed by E. coli , with GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GNA14 Protein, Human (GST) is the recombinant human-derived GNA14, expressed by E. coli , with GST labeled tag.
Background
GNA14 is a guanine nucleotide-binding protein (G proteins) that functions as a modulator or transducer in various transmembrane signaling systems.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag GST
-
Accession
O95837 (M1-V355)
-
Gene ID9630
-
Protein Length
Full Length
-
Synonyms
GNA14; Heterotrimeric Guanine Nucleotide-Binding Protein 1I; G Protein Subunit Alpha 14; Guanine Nucleotide-Binding Protein 14; Guanine Nucleotide Binding Protein (G Protein), Alpha 14; G-Protein Subunit Alpha-14; Guanine Nucleotide-Binding Protein Subuni
-
AA Sequence
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
-
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
