GNA14 Protein, Human (GST)

GNA14 Protein, Human (GST) is the recombinant human-derived GNA14, expressed by E. coli , with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GNA14 Protein, Human (GST) is the recombinant human-derived GNA14, expressed by E. coli , with GST labeled tag.

Background

GNA14 is a guanine nucleotide-binding protein (G proteins) that functions as a modulator or transducer in various transmembrane signaling systems.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    GNA14; Heterotrimeric Guanine Nucleotide-Binding Protein 1I; G Protein Subunit Alpha 14; Guanine Nucleotide-Binding Protein 14; Guanine Nucleotide Binding Protein (G Protein), Alpha 14; G-Protein Subunit Alpha-14; Guanine Nucleotide-Binding Protein Subuni

  • AA Sequence

    MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV

  • Molecular Weight

    Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00