GNGT1 Protein, Human (His)
GNGT1 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, functioning as a modulator or transducer. Its beta and gamma chains facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—collaboratively regulate and transduce signals across cell membranes. GNGT1 Protein, Human (His) is the recombinant human-derived GNGT1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GNGT1 protein, a member of the G protein family, is crucial in diverse transmembrane signaling systems, functioning as a modulator or transducer. Its beta and gamma chains facilitate GTPase activity, enabling GDP-GTP exchange and mediating interactions with effectors. G proteins, with three subunits—alpha, beta, and gamma—collaboratively regulate and transduce signals across cell membranes. GNGT1 Protein, Human (His) is the recombinant human-derived GNGT1 protein, expressed by E. coli , with N-His labeled tag.
Background
GNGT1, a member of the guanine nucleotide-binding protein (G protein) family, serves as a crucial component in diverse transmembrane signaling systems, acting as a modulator or transducer. The beta and gamma chains of GNGT1 play essential roles in facilitating GTPase activity, enabling the exchange of GDP for GTP, and mediating interactions between G proteins and their effectors. The fundamental structure of G proteins consists of three units—alpha, beta, and gamma—working collaboratively to regulate and transduce signals across cell membranes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P63211 (P2-C71)
-
Molecular Construction
-
N-term
-
His
-
GNGT1 (P2-C71)
Accession # P63211 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
GNGT1; Transducin Gamma Chain; G Protein Subunit Gamma Transducin 1; Guanine Nucleotide Binding Protein (G Protein), Gamma Transducing Activity Polypeptide 1, Isoform CRA_a; GNG1; Heterotrimeric Guanine Nucleotide-Binding Protein 3G1; Guanine Nucleotide B
-
AA Sequence
PVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGC
-
Predicted Molecular Mass
9.9 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
