1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Isomerases (EC 5)
  4. GNPDA2 Protein, Human (His)

The GNPDA2 protein catalyzes the reversible conversion of α-D-glucosamine 6-phosphate to β-D-fructose 6-phosphate and ammonium ions, which is a key step in de novo UDP-GlcNAc biosynthesis. GNPDA2 Protein, Human (His) is the recombinant human-derived GNPDA2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GNPDA2 protein catalyzes the reversible conversion of α-D-glucosamine 6-phosphate to β-D-fructose 6-phosphate and ammonium ions, which is a key step in de novo UDP-GlcNAc biosynthesis. GNPDA2 Protein, Human (His) is the recombinant human-derived GNPDA2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The GNPDA2 protein assumes a crucial role in cellular metabolism by catalyzing the reversible conversion of alpha-D-glucosamine 6-phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion. This enzymatic reaction represents a regulatory step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis through the hexosamine pathway. The deamination process is coupled to aldo-keto isomerization, mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. Particularly noteworthy is GNPDA2's capability, under high ammonium levels, to drive amination and isomerization of Fru-6P, promoting hexosamine and UDP-GlcNAc synthesis. This dynamic interplay highlights GNPDA2's role in fine-tuning the metabolic fluctuations of cytosolic UDP-GlcNAc, influencing hyaluronan synthesis during tissue remodeling. The enzyme's regulatory function underscores its significance in coordinating metabolic pathways critical for nucleotide biosynthesis and cellular homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q8TDQ7 (R2-N276)

Gene ID

132789

Molecular Construction
N-term
6*His
GNPDA2 (R2-N276)
Accession # Q8TDQ7
C-term
Protein Length

Partial

Synonyms
GNPDA2; Glucosamine-6-phosphate isomerase 2; Glucosamine-6-phosphate deaminase 2; GNPDA 2; GlcN6P deaminase 2; Glucosamine-6-phosphate isomerase SB52
AA Sequence

RLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GNPDA2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GNPDA2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GNPDA2 Protein, Human (His)
Cat. No.:
HY-P701902
Quantity:
MCE Japan Authorized Agent: