GNPDA2 Protein, Human (His)

The GNPDA2 protein catalyzes the reversible conversion of α-D-glucosamine 6-phosphate to β-D-fructose 6-phosphate and ammonium ions, which is a key step in de novo UDP-GlcNAc biosynthesis. GNPDA2 Protein, Human (His) is the recombinant human-derived GNPDA2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The GNPDA2 protein catalyzes the reversible conversion of α-D-glucosamine 6-phosphate to β-D-fructose 6-phosphate and ammonium ions, which is a key step in de novo UDP-GlcNAc biosynthesis. GNPDA2 Protein, Human (His) is the recombinant human-derived GNPDA2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The GNPDA2 protein assumes a crucial role in cellular metabolism by catalyzing the reversible conversion of alpha-D-glucosamine 6-phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion. This enzymatic reaction represents a regulatory step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis through the hexosamine pathway. The deamination process is coupled to aldo-keto isomerization, mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. Particularly noteworthy is GNPDA2's capability, under high ammonium levels, to drive amination and isomerization of Fru-6P, promoting hexosamine and UDP-GlcNAc synthesis. This dynamic interplay highlights GNPDA2's role in fine-tuning the metabolic fluctuations of cytosolic UDP-GlcNAc, influencing hyaluronan synthesis during tissue remodeling. The enzyme's regulatory function underscores its significance in coordinating metabolic pathways critical for nucleotide biosynthesis and cellular homeostasis.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • GNPDA2 (R2-N276)
      Accession # Q8TDQ7
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GNPDA2; Glucosamine-6-Phosphate Isomerase 2; Glucosamine-6-Phosphate Deaminase 2; GlcN6P Deaminase 2; SB52; GNP2; Glucosamine-6-Phosphate Isomerase SB52; Glucosamine-6-Phosphate Isomerase

  • AA Sequence

    RLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00