GNPDA2 Protein, Human
The GNPDA2 protein catalyzes the reversible conversion of α-D-glucosamine 6-phosphate to β-D-fructose 6-phosphate and ammonium ions, which is a key step in de novo UDP-GlcNAc biosynthesis. GNPDA2 Protein, Human is the recombinant human-derived GNPDA2 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The GNPDA2 protein catalyzes the reversible conversion of α-D-glucosamine 6-phosphate to β-D-fructose 6-phosphate and ammonium ions, which is a key step in de novo UDP-GlcNAc biosynthesis. GNPDA2 Protein, Human is the recombinant human-derived GNPDA2 protein, expressed by E. coli , with tag free.
Background
The GNPDA2 protein assumes a crucial role in cellular metabolism by catalyzing the reversible conversion of alpha-D-glucosamine 6-phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion. This enzymatic reaction represents a regulatory step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis through the hexosamine pathway. The deamination process is coupled to aldo-keto isomerization, mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. Particularly noteworthy is GNPDA2's capability, under high ammonium levels, to drive amination and isomerization of Fru-6P, promoting hexosamine and UDP-GlcNAc synthesis. This dynamic interplay highlights GNPDA2's role in fine-tuning the metabolic fluctuations of cytosolic UDP-GlcNAc, influencing hyaluronan synthesis during tissue remodeling. The enzyme's regulatory function underscores its significance in coordinating metabolic pathways critical for nucleotide biosynthesis and cellular homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8TDQ7 (R2-N276)
-
Gene ID132789
-
Molecular Construction
-
N-term
-
GNPDA2 (R2-N276)
Accession # Q8TDQ7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GNPDA2; Glucosamine-6-Phosphate Isomerase 2; Glucosamine-6-Phosphate Deaminase 2; GlcN6P Deaminase 2; SB52; GNP2; Glucosamine-6-Phosphate Isomerase SB52; Glucosamine-6-Phosphate Isomerase
-
AA Sequence
RLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)