GOLM1 Protein, Human (His)
GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.
GOLM1, while not fully understood, emerges as a cellular response protein to viral infections. Its precise role in this context remains elusive, reflecting the complexity of its functions in cellular processes. Notably, GOLM1 engages in interactions with DYM, hinting at potential associations with pathways related to cellular dynamics or host-virus interactions. The intricate nature of GOLM1's involvement in viral responses underscores the need for further investigation to unravel its specific contributions and implications in the cellular defense mechanisms against viral infections.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8NBJ4-1 (S36-L401)
-
Molecular Construction
-
N-term
-
6*His
-
GOLM1 (S36-L401)
Accession # Q8NBJ4-1 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
GOLM1; FLJ23608; Prev. C9orf155; CDNA PSEC0257 Fis, Clone NT2RP3003642, Highly Similar To Golgi Phosphoprotein 2; Prev. GOLPH2; CDNA FLJ14811 Fis, Clone NT2RP4001975, Highly Similar To Golgi Phosphoprotein 2; Golgi Phosphoprotein 2; Golgi Phosphoprotein 2
-
AA Sequence
SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
-
Predicted Molecular Mass
45.6 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
