GPBAR1 Protein, Human (Cell-Free, His)
Based on 1 Customer Validation
GPBAR1 Protein, Human (Cell-Free, His) is the recombinant human-derived GPBAR1 protein, expressed by E. coli cell-free system, with N-10*His tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPBAR1 Protein, Human (Cell-Free, His) is the recombinant human-derived GPBAR1 protein, expressed by E. coli cell-free system, with N-10*His tag.
Background
GPBAR1 is a receptor for bile acids. Binding of bile acids induces its internalization, activation of extracellular signal-regulated kinase, and intracellular cAMP production. It may be involved in the suppression of macrophage functions by bile acids.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q8TDU6 (M1-N330)
-
Gene ID151306
-
Molecular Construction
-
N-term
-
10*His
-
GPBAR1 (M1-N330)
Accession # Q8TDU6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GPBAR1; Membrane-Type Receptor For Bile Acids; G Protein-Coupled Bile Acid Receptor 1; G-Protein Coupled Receptor GPCR19; M-BAR; MGC40597; BG37; GPCR; TGR5; G-Protein Coupled Bile Acid Receptor BG37; GPCR19; Membrane Bile Acid Receptor; GPR131; HGPCR19; G
-
AA Sequence
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
-
Predicted Molecular Mass
36.8 kDa
-
Molecular Weight
Approximately 34 kDa(Monomer) & 68 kDa(Dimer), based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij78, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
