GPHA2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.
GPHA2 (Glycoprotein Hormone Alpha 2) functions as a crucial heterodimeric glycoprotein hormone alongside GPHB5, with the ability to bind and activate the thyroid-stimulating hormone receptor (TSHR), ultimately resulting in elevated cAMP production. This glycoprotein hormone complex plays a central role in the regulation of thyroid cell metabolism, indicating its significance in the control of thyroid function and hormonal balance. The functional partnership between GPHA2 and GPHB5 is highlighted by their formation of a heterodimer, and this complex specifically interacts with TSHR, thereby initiating the cascade leading to increased cAMP levels.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96T91 (Q24-Y129)
-
Molecular Construction
-
N-term
-
GPHA2 (Q24-Y129)
Accession # Q96T91 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GPHA2; Glycoprotein Hormone Alpha-2; Glycoprotein Hormone Subunit Alpha 2; A2; Thyrostimulin Subunit Alpha; Glycoprotein Hormone Alpha 2; ZSIG51; Cysteine Knot Protein; GPA2; Glycoprotein Alpha 2; Putative Secreted Protein Zsig51; MGC126572
-
AA Sequence
QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
