GPR75 Protein, Human (HEK293, Flag, His)
Based on 1 Customer Validation
GPR75 Protein, Human (HEK293, Flag, His) is the recombinant human-derived GPR75, expressed by HEK293 , with Flag and His labeled tag. ,
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPR75 Protein, Human (HEK293, Flag, His) is the recombinant human-derived GPR75, expressed by HEK293 , with Flag and His labeled tag. ,
Background
GPR75 is a G protein-coupled receptor activated by the chemokine CCL5/RANTES. It is likely coupled to heterotrimeric Gq proteins, stimulating inositol trisphosphate production and calcium mobilization upon activation. Along with CCL5/RANTES, it may contribute to neuron survival by activating a downstream signaling pathway involving PI3, Akt, and MAP kinases. CCL5/RANTES may also regulate insulin secretion in pancreatic islet cells through this receptor's activation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Flag;C-10*His
-
Accession
O95800 (M1-R236, S307-G395)
-
Gene ID10936
-
Protein Length
Partial
-
Synonyms
GPR75; WI-31133; G Protein-Coupled Receptor 75; GPRchr2; Probable G-Protein Coupled Receptor 75; WI31133
-
AA Sequence
SAINLSTAKDSKAVVTCVIIVLSVLVCCLPLGISLVQVVLSSNGSFILYQFELFGFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLQYIG
-
Predicted Molecular Mass
48.9 kDa
-
Molecular Weight
Approximately 49 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.00075% (w/v) LMNG, 0.00025% (w/v) GDN, 0.0001% (w/v) CHS.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
