GPX4 Protein, Human (U73C, HEK293, Flag)
Based on 1 publication(s) in Google Scholar
GPX4 Protein, Human (U73C, HEK293, Flag) is the recombinant human-derived GPX4 protein, expressed by HEK293, with N-Flag tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
GPX4 Protein, Human (U73C, HEK293, Flag) is the recombinant human-derived GPX4 protein, expressed by HEK293, with N-Flag tag.
GPX4 is an essential antioxidant peroxidase that directly reduces phospholipid hydroperoxides, including those incorporated in membranes and lipoproteins (By similarity). It also reduces cholesterol hydroperoxide and thymine hydroperoxide (By similarity), playing a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation (By similarity). GPX4 is required to inhibit ferroptosis, a non-apoptotic cell death caused by iron-dependent accumulation of lipid reactive oxygen species (PubMed:24439385). The presence of selenocysteine (Sec) versus cysteine (Cys) at the active site is critical for life, as it provides resistance to overoxidation and prevents ferroptosis (By similarity). Sec is also essential for the survival of parvalbumin-positive interneurons, thereby preventing fatal epileptic seizures (By similarity). GPX4 may protect cells from the toxicity of ingested lipid hydroperoxides (By similarity) and is indispensable for normal sperm development, male fertility (By similarity), and photoreceptor cell maturation and survival (By similarity). In T-cell responses to viral and parasitic infections, GPX4 prevents ferroptosis and supports T-cell expansion (By similarity). Additionally, it functions as a glutathione peroxidase in platelets during arachidonic acid metabolism (PubMed:11115402) and reduces hydroperoxy ester lipids formed by 15-lipoxygenase, downregulating the cellular 15-lipoxygenase pathway (By similarity). GPX4 can also reduce fatty acid-derived hydroperoxides (PubMed:11115402, PubMed:36608588) and small soluble hydroperoxides such as H2O2, cumene hydroperoxide, and tert-butyl hydroperoxide (PubMed:17630701, PubMed:36608588).
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
Luteolin Induces GPX4-dependent Ferroptosis and Enhances Immune Activation in Colon Cancer. [Abstract]2025 Oct:146:157117. PMID: 40812220
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Flag
-
Accession
P36969-1 (C29-F197, U73C)
-
Gene ID2879
-
Molecular Construction
-
N-term
-
Flag
-
GPX4 (C29-F197, U73C)
Accession # P36969-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
GPX4; Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial; Glutathione Peroxidase 4; Glutathione Peroxidase 4 (Phospholipid Hydroperoxidase); PHGPx; Phospholipid-Hydroperoxide Glutathione Peroxidase; MCSP; Epididymis Secretory Sperm Binding P
-
AA Sequence
CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)