GRP-10 Protein, Canine (HEK293, hFc)
Based on 1 Customer Validation
GRP-10 Protein, Canine (HEK293, hFc) is the recombinant canine-derived GRP-10 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GRP-10 Protein, Canine (HEK293, hFc) is the recombinant canine-derived GRP-10 protein, expressed by HEK293, with C-hFc labeled tag.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-hFc
-
Accession
E2QW58 (A24-G147)
-
Gene ID/
-
Molecular Construction
-
N-term
-
GRP-10 (A24-G147)
Accession # E2QW58 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Gastrin-releasing peptide; GRP
-
AA Sequence
APVPGGQGTVLDKMYPRGNWAVGHLMGKKSTRESPYVYEEGSLKQQLQGYIRWEEAARNLLSLMEAKGTRSHQTPQREPLGIRQSAWDYQDDSNFKVIGPTREVGGLSASGSQPEGRNPPRNHG
-
Predicted Molecular Mass
40.5 kDa
-
Molecular Weight
Approximately 41-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
