GSDMC Protein, Human (His-SUMO)
Based on 1 Customer Validation
GSDMC protein serves as the precursor of pore-forming proteins and undergoes cleavage to release Gasdermin-C. This N-terminal moiety binds to the membrane, forming pores with an inner diameter of 10 to 15 nm and inducing pyroptosis. GSDMC Protein, Human (His-SUMO) is the recombinant human-derived GSDMC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GSDMC protein serves as the precursor of pore-forming proteins and undergoes cleavage to release Gasdermin-C. This N-terminal moiety binds to the membrane, forming pores with an inner diameter of 10 to 15 nm and inducing pyroptosis. GSDMC Protein, Human (His-SUMO) is the recombinant human-derived GSDMC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
GSDMC protein serves as the precursor to the pore-forming protein, and upon cleavage, the released N-terminal moiety, known as Gasdermin-C, binds to membranes and forms pores, leading to the induction of pyroptosis. The pore-forming activity involves the homooligomerization of GSDMC within the membrane, resulting in the formation of pores with inner diameters ranging from 10 to 15 nanometers. This process is initiated by the cleavage of gasdermin-D by caspase CASP8 in response to death signals, and the subsequent movement of the cleaved protein to the plasma membrane, where it exhibits strong binding to the inner leaflet lipids, ultimately triggering pyroptosis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q9BYG8 (M1-A508)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
GSDMC (M1-A508)
Accession # Q9BYG8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GSDMC; Melanoma-Derived Leucine Zipper-Containing Extranuclear Factor; Prev. MLZE; Gasdermin-C; Gasdermin C; Melanoma-Derived Leucine Zipper, Extra-Nuclear Factor
-
AA Sequence
MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA
-
Predicted Molecular Mass
73.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm sterile filtered 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, 6% Irehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
