GSTT2B Protein, Human (HEK293, His)

GSTT2B protein, crucial in conjugating reduced glutathione to hydrophobic electrophiles, is essential for cellular detoxification. Its sulfatase activity adds to its multifunctional role in cellular processes. The combined glutathione conjugation and sulfatase function underscore GSTT2B's versatility in handling diverse substrates, emphasizing its significance in cellular detoxification mechanisms. GSTT2B Protein, Human (HEK293, His) is the recombinant human-derived GSTT2B protein, expressed by HEK293 , with C-His labeled tag.

GSTT2B protein plays a crucial role in the conjugation of reduced glutathione to a diverse array of hydrophobic electrophiles, both exogenous and endogenous. This enzymatic activity is vital for the detoxification process within cells. Additionally, GSTT2B exhibits sulfatase activity, further contributing to its multifunctional role in cellular processes. The combined activities of glutathione conjugation and sulfatase function highlight the versatility of GSTT2B in handling various substrates and underline its significance in cellular detoxification mechanisms.

Measure the activity of peroxidase by detecting the decrease in NADPH. The specific activity is 3550.754 pmol/min/μg.

Human

HEK293

C-6*His

P0CG29 (M1-P244)

653689

Full Length

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP

Approximately 27 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.