Copy Link Print Information

GSTT2B Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

GSTT2B protein, crucial in conjugating reduced glutathione to hydrophobic electrophiles, is essential for cellular detoxification. Its sulfatase activity adds to its multifunctional role in cellular processes. The combined glutathione conjugation and sulfatase function underscore GSTT2B's versatility in handling diverse substrates, emphasizing its significance in cellular detoxification mechanisms. GSTT2B Protein, Human (HEK293, His) is the recombinant human-derived GSTT2B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GSTT2B Protein, Human (HEK293, His)
  • GSTT2B Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GSTT2B protein, crucial in conjugating reduced glutathione to hydrophobic electrophiles, is essential for cellular detoxification. Its sulfatase activity adds to its multifunctional role in cellular processes. The combined glutathione conjugation and sulfatase function underscore GSTT2B's versatility in handling diverse substrates, emphasizing its significance in cellular detoxification mechanisms. GSTT2B Protein, Human (HEK293, His) is the recombinant human-derived GSTT2B protein, expressed by HEK293 , with C-His labeled tag.

Background

GSTT2B protein plays a crucial role in the conjugation of reduced glutathione to a diverse array of hydrophobic electrophiles, both exogenous and endogenous. This enzymatic activity is vital for the detoxification process within cells. Additionally, GSTT2B exhibits sulfatase activity, further contributing to its multifunctional role in cellular processes. The combined activities of glutathione conjugation and sulfatase function highlight the versatility of GSTT2B in handling various substrates and underline its significance in cellular detoxification mechanisms.

Verified Bioactivity

Measure the activity of peroxidase by detecting the decrease in NADPH. The specific activity is 3550.754 pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P0CG29 (M1-P244)

  • Gene ID
    653689
  • Molecular Construction
    • N-term
    • GSTT2B (M1-P244)
      Accession # P0CG29
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GSTT2B; Glutathione S-Transferase Theta 2B (Gene/Pseudogene); Glutathione S-Transferase Theta 2B; Glutathione S-Transferase Theta 2; GSTT2P; Glutathione S-Transferase Theta-2; Glutathione S-Transferase Theta-2B; Glutathione Transferase; GST Class-Theta-2;

  • AA Sequence

    MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP

  • Molecular Weight

    Approximately 27 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • GSTT2B Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for GSTT2B Protein, Human (HEK293, His)
  • GSTT2B Protein, Human (HEK293, His) Product Image