HAdV-E fiber Protein (sf9, His)
Human mastadenoviruses (HAdVs) are non-enveloped, double-stranded DNA viruses. Human adenovirus type 4 (HAdV-E4) is the only type in species Human mastadenovirus E (HAdV-E) thus far isolated from humans. HAdV-E4 infection is associated with acute respiratory disease. HAdV-E fiber Protein (sf9, His) is the recombinant Virus-derived HAdV-E fiber protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Human mastadenoviruses (HAdVs) are non-enveloped, double-stranded DNA viruses. Human adenovirus type 4 (HAdV-E4) is the only type in species Human mastadenovirus E (HAdV-E) thus far isolated from humans. HAdV-E4 infection is associated with acute respiratory disease[1][2]. HAdV-E fiber Protein (sf9, His) is the recombinant Virus-derived HAdV-E fiber protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The more than 89 currently recognized human adenovirus (HAdV) genotypes are categorized into seven species designated Human mastadenovirus A to G (HAdV-A to HAdV-G) based on their genetic characteristics. The genus-specific epitopes on the major antigen hexon are often used for immunological routine diagnosis of adenoviruses. The components of the outer virus capsid hexon and penton are further possessed of the epitopes of neutralizing antibodies. The fiber, which contains a shaft with mainly genus-specific epitopes and a knob with mainly species-specific epitopes, should be suitable for the genus-specific but also for the species-specific immunological diagnosis as already used for serotyping of adenoviruses by hemagglutination inhibition assay based on fiber determinants[1][2].
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
YP_068048.1 (M1-Q425)
-
Gene ID2958476 [NCBI]
-
Molecular Construction
-
N-term
-
Fiber (M1-Q425)
Accession # YP_068048.1 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
Human mastadenovirus E (HAdV-E) fiber Protein (His)
-
AA Sequence
MSKKRARVDDGFDPVYPYDADNAPTVPFINPPFVSSDGFQEKPLGVLSLRLADPVTTKNGEITLKLGEGVDLDDSGKLIANTVNKAIAPLSFSNNTISLNMDTPLYTKDGKLSLQVSPPLSILKSTILNTLALAFGSGLGLSGSALAVQLASPLTFDDKGNIKITLNRGLHVTTGDAIESNISWAKGIKFEDGAIATNIGKGLEFGTSSTETGVNNAYPIQVKLGSGLSFDSTGAIMAGNKDYDKLTLWTTPDPSPNCQILAENDAKLTLCLTKCDSQILATVSVLVVRSGNLNPITGTVSSAQVFLRFDANGVLLTEHSTLKKYWGYKQGDSIDGTPYTNAVGFMPNSTAYPKTQSSTTKNNIVGQVYMNGDVSKPMLLTITLNGTDDTTSAYSMSFSYTWTNGSYIGATFGANSYTFSYIAQQ
-
Predicted Molecular Mass
46.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
