HAdV-E fiber Protein (sf9, His)

Human mastadenoviruses (HAdVs) are non-enveloped, double-stranded DNA viruses. Human adenovirus type 4 (HAdV-E4) is the only type in species Human mastadenovirus E (HAdV-E) thus far isolated from humans. HAdV-E4 infection is associated with acute respiratory disease^[1][2]. HAdV-E fiber Protein (sf9, His) is the recombinant Virus-derived HAdV-E fiber protein, expressed by Sf9 insect cells , with C-His labeled tag.

The more than 89 currently recognized human adenovirus (HAdV) genotypes are categorized into seven species designated Human mastadenovirus A to G (HAdV-A to HAdV-G) based on their genetic characteristics. The genus-specific epitopes on the major antigen hexon are often used for immunological routine diagnosis of adenoviruses. The components of the outer virus capsid hexon and penton are further possessed of the epitopes of neutralizing antibodies. The fiber, which contains a shaft with mainly genus-specific epitopes and a knob with mainly species-specific epitopes, should be suitable for the genus-specific but also for the species-specific immunological diagnosis as already used for serotyping of adenoviruses by hemagglutination inhibition assay based on fiber determinants^[1][2].

Virus

Sf9 insect cells

C-His

YP_068048.1 (M1-Q425)

2958476  [NCBI]

Full Length

MSKKRARVDDGFDPVYPYDADNAPTVPFINPPFVSSDGFQEKPLGVLSLRLADPVTTKNGEITLKLGEGVDLDDSGKLIANTVNKAIAPLSFSNNTISLNMDTPLYTKDGKLSLQVSPPLSILKSTILNTLALAFGSGLGLSGSALAVQLASPLTFDDKGNIKITLNRGLHVTTGDAIESNISWAKGIKFEDGAIATNIGKGLEFGTSSTETGVNNAYPIQVKLGSGLSFDSTGAIMAGNKDYDKLTLWTTPDPSPNCQILAENDAKLTLCLTKCDSQILATVSVLVVRSGNLNPITGTVSSAQVFLRFDANGVLLTEHSTLKKYWGYKQGDSIDGTPYTNAVGFMPNSTAYPKTQSSTTKNNIVGQVYMNGDVSKPMLLTITLNGTDDTTSAYSMSFSYTWTNGSYIGATFGANSYTFSYIAQQ

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.