Copy Link Print Information

HDGFL2 Protein, Human (His, Strep)

Customer Review

Based on 1 Customer Validation

HDGFL2 Protein, Human (His, Strep) is the recombinant human-derived HDGFL2, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • HDGFL2 Protein, Human (His, Strep) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HDGFL2 Protein, Human (His, Strep) is the recombinant human-derived HDGFL2, expressed by E. coli , with Strep, His labeled tag.

Background

HDGFL2 acts as an epigenetic regulator of myogenesis in cooperation with DPF3a (isoform 2 of DPF3/BAF45C). It associates with the BAF complex via interaction with DPF3a, and the HDGFL2-DPF3a complex activates myogenic genes by increasing chromatin accessibility through recruitment of SMARCA4/BRG1/BAF190A (the ATPase subunit of the BAF complex) to myogenic gene promoters. Additionally, HDGFL2 promotes the repair of DNA double-strand breaks (DSBs) via the homologous recombination pathway by facilitating the recruitment of the DNA endonuclease RBBP8 to DSBs. It preferentially binds to chromatin regions marked by H3K9me3, H3K27me3, and H3K36me2 and is involved in cellular growth control through the regulation of cyclin D1 expression.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-StrepⅡ
  • Accession

    Q7Z4V5-1 (M1-S93)

  • Gene ID
    84717
  • Protein Length

    Partial

  • Synonyms

    HDGFL2; HDGF-2; HDGF Like 2; HDGF2; HRP2; HRP-2; Hdgfrp2; Hepatoma-Derived Growth Factor Related Protein 2; Hepatoma-Derived Growth Factor-Related Protein 2; Hepatoma-Derived Growth Factor 2; HDGF-Related Protein 2; HDGFRP2

  • AA Sequence

    MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS

  • Predicted Molecular Mass

    13.8 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200mM NaCl, 20% glycerol, 1mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HDGFL2 Protein, Human (His, Strep) Product Image
    1/16
  • HDGFL2 Protein, Human (His, Strep) Product Image