Hemopexin Protein, Human (HEK293, C-His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Hemopexin Protein efficiently binds heme, facilitating its transport to the liver for degradation and subsequent recovery of iron. Once this crucial process is complete, the liberated hemopexin seamlessly re-enters circulation. Additionally, it engages in interactions with FLVCR1, contributing to its multifaceted role in heme metabolism and iron homeostasis.

Measured by its ability to bind protoporphyrin IX (PPP-IX). Recombinant Human Hemopexin binds 42.85 μM PPP-IX, resulting in a 50% decrease in the fluorescence signal of rhHemopexin.

Human

HEK293

C-6*His

P02790 (T24-H462)

3263

Full Length of Mature Protein

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Approximately 60-90 kDa due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.