Hemopexin Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (HEK293, His) is the recombinant rat-derived Hemopexin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (HEK293, His) is the recombinant rat-derived Hemopexin protein, expressed by HEK293 , with C-His labeled tag.
Background
The Hemopexin protein exhibits the ability to bind to heme, serving as a transporter to facilitate its transportation to the liver. Once in the liver, heme is broken down, and the iron is recovered. Subsequently, the hemopexin protein, now free from heme, returns to circulation. This mechanism highlights the crucial role of hemopexin in the efficient management of heme and iron metabolism within the body.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P20059 (N24-Q460)
-
Molecular Construction
-
N-term
-
Hemopexin (N24-Q460)
Accession # P20059 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HPX; Epididymis Secretory Sperm Binding Protein; Hemopexin; HX; Beta-1B-Glycoprotein
-
AA Sequence
NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ
-
Predicted Molecular Mass
50.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
