Copy Link Print Information

HEPACAM Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • HEPACAM Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HEPACAM proteins are key regulators of cell motility, interacting with the extracellular matrix to inhibit cell growth and maintain cellular homeostasis. HEPACAM forms homodimers through cis interactions, is a component of the MLC1, TRPV4, AQP4 and ATP1B1 complexes and participates in key molecular interactions. HEPACAM Protein, Human (HEK293, His) is the recombinant human-derived HEPACAM protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HEPACAM protein emerges as a key regulator in the intricate orchestration of cell motility and interactions with the extracellular matrix. It exhibits the potential to curb cell growth by suppressing proliferation, suggesting a role in maintaining cellular homeostasis. The protein forms homodimers, with dimerization predominantly occurring through cis interactions on the cell surface. Notably, it is integral to a complex that includes MLC1, TRPV4, AQP4, and ATP1B1, highlighting its participation in a network of molecular interactions crucial for various cellular processes. The multifaceted involvement of HEPACAM underscores its significance in the intricate landscape of cellular dynamics and growth regulation.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q14CZ8-1/NP_689935.2 (V34-S240)

  • Gene ID
    220296  [NCBI]
  • Molecular Construction
    • N-term
    • HEPACAM (V34-S240)
      Accession # Q14CZ8-1/NP_689935.2
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    HEPACAM; Glial Cell Adhesion Molecule; Hepatic And Glial Cell Adhesion Molecule; Alternative Protein HEPACAM; Hepatocyte Cell Adhesion Molecule; GlialCAM; GLIALCAM; MLC2A; Protein HepaCAM; MLC2B; FLJ25530

  • AA Sequence

    VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSS

  • Predicted Molecular Mass

    24.1 kDa

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HEPACAM Protein, Human (HEK293, His) Product Image
    1/16
  • HEPACAM Protein, Human (HEK293, His) Product Image