HER3 Protein, Human (Biotinylated, HEK293, His)
HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.
Background
HER3, a tyrosine-protein kinase, serves as a critical cell surface receptor for neuregulins. Activated by neuregulin-1 (NRG1), ligand binding enhances phosphorylation on tyrosine residues and facilitates its interaction with the p85 subunit of phosphatidylinositol 3-kinase. Additionally, there is evidence suggesting activation by CSPG5. HER3 is intricately involved in the regulation of myeloid cell differentiation, highlighting its pivotal role in cellular processes crucial for normal development and function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P21860-1/NP_001973.2 (S20-T643)
-
Molecular Construction
-
N-term
-
HER3 (S20-T643)
Accession # P21860-1/NP_001973.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
ERBB3; Receptor Protein-Tyrosine Kinase; Prev. LCCS2; P45-SErbB3; HER3; P85-SErbB3; V-Erb-B2 Avian Erythroblastic Leukemia Viral Oncogene Homolog 3; ErbB-3 R31; Tyrosine Kinase-Type Cell Surface Receptor HER3; MDA-BF-1; Human Epidermal Growth Factor Recep
-
AA Sequence
SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT
-
Predicted Molecular Mass
70.2 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
