Copy Link Print Information

HER3 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Rat (HEK293, His) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for HER3 Protein, Rat (HEK293, His)
  • Experimental Validation Results for HER3 Protein, Rat (HEK293, His)
  • HER3 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Rat (HEK293, His) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.

Background

HER3, a tyrosine-protein kinase, serves as a critical cell surface receptor for neuregulins. Activated by neuregulin-1 (NRG1), ligand binding enhances phosphorylation on tyrosine residues and facilitates its interaction with the p85 subunit of phosphatidylinositol 3-kinase. Additionally, there is evidence suggesting activation by CSPG5. HER3 is intricately involved in the regulation of myeloid cell differentiation, highlighting its pivotal role in cellular processes crucial for normal development and function.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.2227 μg/mL in the presence of 10 ng/mL Recombinant Human NRG1‑beta1 (HY-P70524), corresponding to a specific activity is 4490.34 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    G3V6N1/XP_017450189.1 (S20-H641)

  • Gene ID
    29496
  • Molecular Construction
    • N-term
    • HER3 (S20-H641)
      Accession # G3V6N1/XP_017450189.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ERBB3; Receptor Protein-Tyrosine Kinase; Prev. LCCS2; P45-SErbB3; HER3; P85-SErbB3; V-Erb-B2 Avian Erythroblastic Leukemia Viral Oncogene Homolog 3; ErbB-3 R31; Tyrosine Kinase-Type Cell Surface Receptor HER3; MDA-BF-1; Human Epidermal Growth Factor Recep

  • AA Sequence

    SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCHEVCKGRCWGPGPDDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRRFNDSGACVPRCPEPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTFCVRACPPDKMEVDKHGLKMCEPCGGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPSEERLDIKYNRPLGECLAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNFLQGEPREFVHEAQCFSCHPECLPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCNGPELQDCLGQAEVLMSKPH

  • Molecular Weight

    Approximately 112 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.2227 μg/mL in the presence of 10 ng/mL Recombinant Human NRG1‑beta1 (HY-P70524), corresponding to a specific activity is 4490.34 units/mg.

  • HER3 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for HER3 Protein, Rat (HEK293, His)
  • Experimental Validation Results for HER3 Protein, Rat (HEK293, His)
  • HER3 Protein, Rat (HEK293, His) Product Image