Copy Link Print Information

HHLA2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Human (HEK293, His) is the recombinant human-derived HHLA2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • HHLA2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HHLA2 protein, a key immune regulator, interacts with TMIGD2, providing crucial costimulation for T-cells during TCR-mediated activation. This interaction amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade, revealing HHLA2's role in enhancing T-cell responses and immune modulation. HHLA2 Protein, Human (HEK293, His) is the recombinant human-derived HHLA2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The HHLA2 protein, a pivotal player in immune regulation, engages in a significant interaction with TMIGD2 to provide costimulation to T-cells during T-cell receptor (TCR)-mediated activation. This interaction, in turn, amplifies T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. The collaboration between HHLA2 and TMIGD2 underscores the intricate molecular mechanisms involved in enhancing T-cell responses, shedding light on its role in immune modulation.

Verified Bioactivity

1. Immobilized HHLA2 Protein, Human, Recombinant (His Tag) at 2 μg/mL (100 μL/well) can bind CD28H/TMIGD2 Protein, Human, Recombinant (ECD, hFc Tag), the EC50 is 33.3 ng/mL.
2. Loaded Recombinant Human B7-H7 / HHLA2 Protein, His Tag on His1K Biosensor, can bind Recombinant Human KIR3DL3 Protein, hFc Tag with an affinity constant of 18.5 nM as determined in BLI assay (Sartorius Octet RED384).

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q9UM44-1/NP_009003.1 (I23-N344)

  • Gene ID
    11148  [NCBI]
  • Molecular Construction
    • N-term
    • HHLA2 (I23-N344)
      Accession # Q9UM44-1/NP_009003.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HHLA2; B7y; HHLA2 Member Of B7 Family; Human Endogenous Retrovirus-H Long Terminal Repeat-Associating Protein 2; B7-H5; HERV-H LTR-Associating Protein 2; B7-H7; HERV-H LTR-Associating 2; B7H7

  • AA Sequence

    IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHN

  • Predicted Molecular Mass

    38.4 kDa

  • Molecular Weight

    Approximately 50-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HHLA2 Protein, Human (HEK293, His) Product Image
    1/16
  • HHLA2 Protein, Human (HEK293, His) Product Image