Hirudin Protein, Poecilobdella viridis (P. pastoris)
Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.
- Species: Others
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.
Background
Hirudin Protein emerges as a potent thrombin-specific protease inhibitor, showcasing its ability to form a stable non-covalent complex with alpha-thrombin. This interaction results in the effective abolition of alpha-thrombin's capacity to cleave fibrinogen, underscoring the critical role of hirudin in modulating key steps in the coagulation cascade. The specific and targeted inhibition of thrombin by hirudin highlights its significance as a therapeutic agent, particularly in contexts where precise regulation of blood clotting is essential.
Technical Parameters
-
Species Others
-
Source P. pastoris
-
Tag Tag Free
-
Accession
P84590 (V1-L63)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Hirudin (V1-L63)
Accession # P84590 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Hirudin
-
AA Sequence
VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL
-
Predicted Molecular Mass
6.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
