Copy Link Print Information

Histone H1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Histone H1 proteins, particularly the H1.0 variant, are crucial for condensing nucleosome chains, organizing and compacting chromatin. H1.0 is prevalent in cells undergoing terminal differentiation or with low cell division rates. Histone H1 Protein, Human (His) is the recombinant human-derived Histone H1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Histone H1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Histone H1 proteins, particularly the H1.0 variant, are crucial for condensing nucleosome chains, organizing and compacting chromatin. H1.0 is prevalent in cells undergoing terminal differentiation or with low cell division rates. Histone H1 Protein, Human (His) is the recombinant human-derived Histone H1 protein, expressed by E. coli , with N-His labeled tag.

Background

Histone H1 proteins play a vital role in condensing nucleosome chains into higher-order structures, contributing to the organization and compaction of chromatin. Notably, the histone H1.0 variant is predominantly present in cells undergoing terminal stages of differentiation or exhibiting low rates of cell division.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession

    P07305-1 (M1-K194)

  • Gene ID
    3005  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • Histone H1 (M1-K194)
      Accession # P07305-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    H1-0; H1.0, H1(0), H1-0; Prev. H1F0; Histone H1.0; Prev. H1FV; Histone H1'; H1.0; H1 Histone Family, Member 0; H1 Histone Family Member 0; H10; H1.0 Linker Histone; Histone H1(0)

  • AA Sequence

    MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

  • Predicted Molecular Mass

    22.4 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 50 mM Tris, 600 mM NaCl, 1 mM DTT, pH 8.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Supplied as a 0.22 μm filtered solution of 50 mM Tris, 600 mM NaCl, 1 mM DTT, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Histone H1 Protein, Human (His) Product Image
    1/16
  • Histone H1 Protein, Human (His) Product Image