Histone-H2B Protein, Xenopus laevis
Based on 1 Customer Validation
Histone-H2B Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone-H2B, expressed by E. coli , with tag Free labeled tag. ,
- Species: Xenopus laevis
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Histone-H2B Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone-H2B, expressed by E. coli , with tag Free labeled tag. ,
Technical Parameters
-
Species Xenopus laevis
-
Source E. coli
-
Tag Tag Free
-
Accession
A0A6I8QAK0 (M1-K126)
-
Gene ID100485294
-
Protein Length
Full Length
-
Synonyms
Histone H2B; LOC116411635; LOC100485294; LOC100487485; LOC100492632; LOC100496436; LOC100497915; LOC100498072; LOC100498329; LOC100498647; LOC101730940; LOC101734862; LOC116407583; LOC116411634
-
AA Sequence
MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 10 mM Tris-HCl (pH 7.5), 50 mM NaCl, 2 mM β-ME, 2 mM EDTA.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
