Histone H3.3 Protein, Human (His)
Based on 1 Customer Validation
Histone H3.3 Protein, Human (His) is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Histone H3.3 Protein, Human (His) is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with His tag.
Background
Histone H3, a fundamental component of the nucleosome, serves as a linchpin in the intricate process of wrapping and compacting DNA into chromatin, which in turn restricts DNA accessibility to cellular machineries requiring DNA as a template. This histone, alongside its counterparts, assumes a pivotal role in pivotal cellular functions, including transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The regulation of DNA accessibility involves a sophisticated interplay of post-translational modifications collectively referred to as the histone code, coupled with the dynamic remodeling of nucleosomes. The nucleosome itself comprises a histone octamer, composed of two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, exemplifying its indispensable role in organizing chromatin structure and facilitating crucial genomic processes. Additionally, Histone H3 interacts with various cellular components such as TONSL, CHAF1A, CHAF1B, MCM2, and DNAJC9, further contributing to its multifaceted functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-Avi
-
Accession
P84243 (M1-A136)
-
Gene ID3020
-
Protein Length
Full Length
-
Synonyms
H3-3A; H3 Histone, Family 3A; Prev. H3F3A; Histone H3; Prev. H3F3; BRYLIB1; H3.3A; H3F3B; H3 Histone Family Member 3A; H3.3B; H3.3 Histone A; Histone H3.3
-
AA Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
-
Predicted Molecular Mass
18.9 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 2 mM β-ME, 10% glycerol, 2 mM EDTA.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)