Histone H3.3 Protein, Human (G34R)

Histone H3.3 Protein, Human (G34R) is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with tag free tag.

Histone H3, a fundamental component of the nucleosome, serves as a linchpin in the intricate process of wrapping and compacting DNA into chromatin, which in turn restricts DNA accessibility to cellular machineries requiring DNA as a template. This histone, alongside its counterparts, assumes a pivotal role in pivotal cellular functions, including transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The regulation of DNA accessibility involves a sophisticated interplay of post-translational modifications collectively referred to as the histone code, coupled with the dynamic remodeling of nucleosomes. The nucleosome itself comprises a histone octamer, composed of two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, exemplifying its indispensable role in organizing chromatin structure and facilitating crucial genomic processes. Additionally, Histone H3 interacts with various cellular components such as TONSL, CHAF1A, CHAF1B, MCM2, and DNAJC9, further contributing to its multifaceted functions.

Human

E. coli

Tag Free

P84243 (M1-A136, G34R)

3020

Full Length

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTRGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.