1. Recombinant Proteins
  2. Others
  3. Histone H3.3 Protein, Human (G34V)

Histone H3.3 Protein, Human (G34V) is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Histone H3.3 Protein, Human (G34V) is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with tag free tag.

Background

Histone H3, a fundamental component of the nucleosome, serves as a linchpin in the intricate process of wrapping and compacting DNA into chromatin, which in turn restricts DNA accessibility to cellular machineries requiring DNA as a template. This histone, alongside its counterparts, assumes a pivotal role in pivotal cellular functions, including transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The regulation of DNA accessibility involves a sophisticated interplay of post-translational modifications collectively referred to as the histone code, coupled with the dynamic remodeling of nucleosomes. The nucleosome itself comprises a histone octamer, composed of two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, exemplifying its indispensable role in organizing chromatin structure and facilitating crucial genomic processes. Additionally, Histone H3 interacts with various cellular components such as TONSL, CHAF1A, CHAF1B, MCM2, and DNAJC9, further contributing to its multifaceted functions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P84243 (M1-A136, G34V)

Gene ID

3020

Protein Length

Full Length

Synonyms
H3.3A; H3F3; H3F3A
AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPSTVGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Predicted Molecular Mass
15.37 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Histone H3.3 Protein, Human (G34V) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Histone H3.3 Protein, Human (G34V)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Histone H3.3 Protein, Human (G34V)
Cat. No.:
HY-P703146
Quantity:
MCE Japan Authorized Agent: