HLTF Protein, Human
Based on 1 Customer Validation
HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human is the recombinant human-derived HLTF protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HLTF protein has helicase and E3 ubiquitin ligase activities and has intrinsic ATP-dependent nucleosome remodeling ability. It is critical for the transcriptional regulation of specific promoters such as SERPINE1, HIV-1 and SV40. HLTF Protein, Human is the recombinant human-derived HLTF protein, expressed by E. coli , with tag free.
HLTF Protein exhibits both helicase and E3 ubiquitin ligase activities. With intrinsic ATP-dependent nucleosome-remodeling capabilities, it may be essential for the transcriptional modulation of specific target promoters such as SERPINE1, HIV-1, and SV40. Furthermore, HLTF plays a crucial role in error-free postreplication repair (PRR) of damaged DNA, contributing to genomic stability by acting as a ubiquitin ligase that catalyzes 'Lys-63'-linked polyubiquitination of chromatin-bound PCNA. These functions highlight its significance in maintaining the integrity of genomic processes and regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q14527 (V58-A174)
-
Gene ID6596
-
Molecular Construction
-
N-term
-
HLTF (V58-A174)
Accession # Q14527 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HLTF; Helicase-like transcription factor; DNA-binding protein/plasminogen activator inhibitor 1 regulator; HIP116; RING finger protein 80; RING-type E3 ubiquitin transferase HLTF; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3; Sucrose nonfermenting protein 2-like 3
-
AA Sequence
VLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPA
-
Predicted Molecular Mass
13.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
