HN1 Protein, Mouse (His)
Based on 1 Customer Validation
HN1 protein negatively regulates AKT-mediated GSK3B signaling and induces the phosphorylation and degradation of CTNNB1 at “Ser-33”. This effect inhibits the “Ser-9” phosphorylation of GSK3B, inhibits the activity of APC:CTNNB1:GSK3B complex and blocks its interaction with CDH1. HN1 Protein, Mouse (His) is the recombinant mouse-derived HN1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HN1 protein negatively regulates AKT-mediated GSK3B signaling and induces the phosphorylation and degradation of CTNNB1 at “Ser-33”. This effect inhibits the “Ser-9” phosphorylation of GSK3B, inhibits the activity of APC:CTNNB1:GSK3B complex and blocks its interaction with CDH1. HN1 Protein, Mouse (His) is the recombinant mouse-derived HN1 protein, expressed by E. coli , with N-His labeled tag.
HN1 protein emerges as a key regulator in cellular processes, exerting a negative modulatory effect on AKT-mediated GSK3B signaling. It functions by inducing the phosphorylation and subsequent degradation of CTNNB1 at 'Ser-33.' This action is achieved through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, thereby dampening the activity of the APC:CTNNB1:GSK3B complex and impeding its interaction with CDH1/E-cadherin in adherent junctions. Beyond its role in cell adhesion, HN1 participates in the regulation of cell cycle dynamics, as evidenced by its impact on these fundamental cellular processes. Moreover, HN1 exhibits an inhibitory role in the AR-signaling pathway, contributing to the proteasomal degradation of the receptor. Notably, HN1 engages in interactions with the APC:CTNNB1:GSK3B complex, specifically with the inactive form of GSK3B phosphorylated at 'Ser-9,' highlighting its involvement in intricate cellular signaling networks.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P97825 (M1-G154)
-
Molecular Construction
-
N-term
-
His
-
HN1 (M1-G154)
Accession # P97825 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
JPT1; Androgen-Regulated Protein 2; Prev. HN1; Hematological And Neurological Expressed 1 Protein; ARM2; Hematological And Neurological Expressed 1; Jupiter Microtubule Associated Homolog 1; HN1A
-
AA Sequence
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
-
Molecular Weight
Approximately 24 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
