HNF1A Protein, Human (His, Strep)
Based on 1 Customer Validation
HNF1A Protein, Human (His, Strep) is the recombinant human-derived HNF1A, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HNF1A Protein, Human (His, Strep) is the recombinant human-derived HNF1A, expressed by E. coli , with Strep, His labeled tag. ,
Background
HNF1A is a transcriptional activator that regulates the tissue-specific expression of multiple genes, particularly in pancreatic islet cells and liver (by similar). It binds to the inverted palindrome sequence 5'-GTTAATNATTAAC-3' and activates the transcription of genes such as CYP1A2, CYP2E1, and CYP3A11 (by similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P20823-1 (I85-R278)
-
Gene ID6927
-
Protein Length
Partial
-
Synonyms
HNF1A; HNF1 Alpha A Splice Variant 3; Prev. TCF1; HNF1 Alpha A Splice Variant 5; Prev. MODY3; HNF1 Alpha A Splice Variant 6; LFB1; HNF1 Alpha A Splice Variant 7; HNF1; HNF1 Alpha A Splice Variant 8; Liver-Specific Transcription Factor LF-B1; HNF1 Alpha B Splice Variant 5; Hepatocyte Nuclear Factor 1-Alpha; HNF1 Alpha B Splice Variant 3; HNF-1-Alpha; HNF1 Alpha B Splice Variant 6; HNF-1A; HNF1 Alpha A Splice Variant 2; TCF-1; Hepatic Nuclear Factor 1; Transcription Factor 1, Hepatic LF-B1, Hepatic Nuclear Factor (HNF1), Albumin Proximal Factor, Isoform CRA_b; Albumin Proximal Factor; Transcription Factor 1, Hepatic; LF-B1, Hepatic Nuclear Factor (HNF1), Albumin Proximal Factor; Transcription Factor 1; Interferon Production Regulator Factor; HNF1alpha; Transcription Factor 1, Hepatic; IDDM20; HNF1 Alpha A Splice Variant 1; HNF1α; HNF1 Homeobox A; HNF1 Alpha A Splice Variant 4
-
AA Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
