HNF1A Protein, Human (His, Strep)

HNF1A Protein, Human (His, Strep) is the recombinant human-derived HNF1A, expressed by E. coli , with Strep, His labeled tag. ,

HNF1A is a transcriptional activator that regulates the tissue-specific expression of multiple genes, particularly in pancreatic islet cells and liver (by similar). It binds to the inverted palindrome sequence 5'-GTTAATNATTAAC-3' and activates the transcription of genes such as CYP1A2, CYP2E1, and CYP3A11 (by similar).

Human

E. coli

Strep;His

P20823-1 (I85-R278)

6927

Partial

ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM HEPES (pH 7.5), 200mM NaCl, 20% glycerol, 1mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.