HSP10/EPF Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The HSP10/EPF protein is a cochaperone that plays a role in mitochondrial protein import and assembly. HSP10/EPF Protein, Human (His) is the recombinant human-derived HSP10/EPF protein, expressed by E. coli , with N-His, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The HSP10/EPF protein is a cochaperone that plays a role in mitochondrial protein import and assembly. HSP10/EPF Protein, Human (His) is the recombinant human-derived HSP10/EPF protein, expressed by E. coli , with N-His, N-6*His labeled tag.

Background

The HSP10/EPF protein functions as a co-chaperonin actively involved in mitochondrial protein import and macromolecular assembly. Collaborating with Hsp60, it facilitates the correct folding of imported proteins and, under stress conditions in the mitochondrial matrix, may prevent misfolding while promoting the refolding and proper assembly of unfolded polypeptides. The operational units of these chaperonins comprise heptameric rings of the large subunit Hsp60, forming a back-to-back double ring structure. In a cyclic process, Hsp60 ring complexes bind unfolded substrate proteins, followed by ATP binding and association with two heptameric rings of the co-chaperonin Hsp10. This leads to the sequestration of the substrate protein within the inner cavity of Hsp60, allowing for undisturbed folding. Synchronous ATP hydrolysis in all Hsp60 subunits results in the dissociation of the chaperonin rings, releasing ADP and the folded substrate protein. The HSP10/EPF protein forms a homoheptamer arranged in a ring structure and interacts with a Hsp60 tetradecamer to create the symmetrical football complex. These molecular interactions underscore the essential role of HSP10/EPF in orchestrating the folding and assembly of mitochondrial proteins.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    HSPE1; Heat Shock 10kD Protein 1 (Chaperonin 10); Heat Shock Protein Family E (Hsp10) Member 1; Heat Shock Protein Family E Member 1; Chaperonin 10; Heat Shock 10kDa Protein 1; CPN10; Early-Pregnancy Factor; EPF; Heat Shock 10kDa Protein 1 (Chaperonin 10)

  • AA Sequence

    MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

  • Molecular Weight

    Approximately 13 kDa.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00