HSPA13 Protein, Human (His, Strep)
HSPA13 Protein, Human (His, Strep) is the recombinant human-derived HSPA13, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HSPA13 Protein, Human (His, Strep) is the recombinant human-derived HSPA13, expressed by E. coli , with Strep, His labeled tag. ,
Background
HSPA13 is a protein with peptide-independent ATPase activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P48723 (Q23-N471, S450F)
-
Gene ID6782
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HSPA13; Stress 70 Protein Chaperone, Microsome-Associated, 60kD; Prev. STCH; Heat Shock Protein Family A Member 13; Stress-70 Protein Chaperone Microsome-Associated 60 KDa Protein; Testis Secretory Sperm-Binding Protein Li 199a; Heat Shock 70 KDa Protein
-
AA Sequence
QQYLPLPTPKVIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGYESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEFSVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN
-
Predicted Molecular Mass
52.9 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
