HTRA2/OMI Protein, Human (His)
Based on 1 publication(s) in Google Scholar
HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms.It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity.Additionally, during apoptosis, it cleaves THAP5, promoting its degradation.Notably, isoform 2 lacks apparent proteolytic activity.HTRA2/OMI Protein, Human (His) is the recombinant human-derived HTRA2/OMI protein, expressed by E.coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms.It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity.Additionally, during apoptosis, it cleaves THAP5, promoting its degradation.Notably, isoform 2 lacks apparent proteolytic activity.HTRA2/OMI Protein, Human (His) is the recombinant human-derived HTRA2/OMI protein, expressed by E.coli , with C-His labeled tag.
Background
HTRA2/OMI, a serine protease, exhibits proteolytic activity against a non-specific substrate, beta-casein. It plays a pivotal role in cell death induction through multiple mechanisms. One mechanism involves direct binding to and inhibition of BIRC proteins (inhibitor of apoptosis proteins, IAPs), leading to heightened caspase activity. Alternatively, HTRA2/OMI can induce cell death through a BIRC inhibition-independent, caspase-independent pathway, relying on its serine protease activity. Furthermore, during apoptosis, it cleaves THAP5, promoting its degradation. Notably, isoform 2 appears to lack proteolytic activity.
Verified Bioactivity
Protease activity demonstrated by HtrA2 cleavage of bovine β-casein. Incubation of β-casein at 0.2 mg/mL with HTRA2/OMI Protein, Human (His) at 0.02 mg/mL (ratio of 10:1) for 60 minutes at 45°C in 50 mM Tris, pH 8.0, which results in >95% cleavage of β-casein, as revealed by SDS-PAGE.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Nat Cell Biol
Delivery of low-density lipoprotein from endocytic carriers to mitochondria supports steroidogenesis. [Abstract]2023 Jul;25(7):937-949. PMID: 37277481
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-His
-
Accession
O43464 (A134-E458)
-
Molecular Construction
-
N-term
-
HTRA2 (A134-E458)
Accession # O43464 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HTRA2; Serine Protease 25; Prev. PRSS25; Protease, Serine, 25; OMI; Epididymis Secretory Sperm Binding Protein; High Temperature Requirement Protein A2; Mitochondrial Serine Protease; Serine Protease HTRA2, Mitochondrial; HtrA-Like Serine Protease; Omi St
-
AA Sequence
AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
-
Predicted Molecular Mass
36.5 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.3M NaCl, 1 mM DTT, 20% glycerol, pH 7.8.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)