Copy Link Print Information

HTRA2/OMI Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms.It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity.Additionally, during apoptosis, it cleaves THAP5, promoting its degradation.Notably, isoform 2 lacks apparent proteolytic activity.HTRA2/OMI Protein, Human (His) is the recombinant human-derived HTRA2/OMI protein, expressed by E.coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for HTRA2/OMI Protein, Human (His)
  • HTRA2/OMI Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms.It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity.Additionally, during apoptosis, it cleaves THAP5, promoting its degradation.Notably, isoform 2 lacks apparent proteolytic activity.HTRA2/OMI Protein, Human (His) is the recombinant human-derived HTRA2/OMI protein, expressed by E.coli , with C-His labeled tag.

Background

HTRA2/OMI, a serine protease, exhibits proteolytic activity against a non-specific substrate, beta-casein. It plays a pivotal role in cell death induction through multiple mechanisms. One mechanism involves direct binding to and inhibition of BIRC proteins (inhibitor of apoptosis proteins, IAPs), leading to heightened caspase activity. Alternatively, HTRA2/OMI can induce cell death through a BIRC inhibition-independent, caspase-independent pathway, relying on its serine protease activity. Furthermore, during apoptosis, it cleaves THAP5, promoting its degradation. Notably, isoform 2 appears to lack proteolytic activity.

Verified Bioactivity

Protease activity demonstrated by HtrA2 cleavage of bovine β-casein. Incubation of β-casein at 0.2 mg/mL with HTRA2/OMI Protein, Human (His) at 0.02 mg/mL (ratio of 10:1) for 60 minutes at 45°C in 50 mM Tris, pH 8.0, which results in >95% cleavage of β-casein, as revealed by SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-His
  • Accession

    O43464 (A134-E458)

  • Gene ID
    27429  [NCBI]
  • Molecular Construction
    • N-term
    • HTRA2 (A134-E458)
      Accession # O43464
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    HTRA2; Serine Protease 25; Prev. PRSS25; Protease, Serine, 25; OMI; Epididymis Secretory Sperm Binding Protein; High Temperature Requirement Protein A2; Mitochondrial Serine Protease; Serine Protease HTRA2, Mitochondrial; HtrA-Like Serine Protease; Omi St

  • AA Sequence

    AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE

  • Predicted Molecular Mass

    36.5 kDa

  • Molecular Weight

    Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.3M NaCl, 1 mM DTT, 20% glycerol, pH 7.8.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • HTRA2/OMI Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for HTRA2/OMI Protein, Human (His)
  • HTRA2/OMI Protein, Human (His) Product Image