1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. HTRA2/OMI Protein, Human (His)

HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms.It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity.Additionally, during apoptosis, it cleaves THAP5, promoting its degradation.Notably, isoform 2 lacks apparent proteolytic activity.HTRA2/OMI Protein, Human (His) is the recombinant human-derived HTRA2/OMI protein, expressed by E.coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE HTRA2/OMI Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HTRA2/OMI, a serine protease, crucially induces cell death via multiple mechanisms.It directly inhibits BIRC proteins, intensifying caspase activity, and can also induce cell death through a BIRC-independent, caspase-independent pathway, relying on its serine protease activity.Additionally, during apoptosis, it cleaves THAP5, promoting its degradation.Notably, isoform 2 lacks apparent proteolytic activity.HTRA2/OMI Protein, Human (His) is the recombinant human-derived HTRA2/OMI protein, expressed by E.coli , with C-His labeled tag.

Background

HTRA2/OMI, a serine protease, exhibits proteolytic activity against a non-specific substrate, beta-casein. It plays a pivotal role in cell death induction through multiple mechanisms. One mechanism involves direct binding to and inhibition of BIRC proteins (inhibitor of apoptosis proteins, IAPs), leading to heightened caspase activity. Alternatively, HTRA2/OMI can induce cell death through a BIRC inhibition-independent, caspase-independent pathway, relying on its serine protease activity. Furthermore, during apoptosis, it cleaves THAP5, promoting its degradation. Notably, isoform 2 appears to lack proteolytic activity.

Biological Activity

Protease activity demonstrated by HtrA2 cleavage of bovine β-casein. Incubation of β-casein at 0.2 mg/mL with HTRA2/OMI Protein, Human (His) at 0.02 mg/mL (ratio of 10:1) for 60 minutes at 45°C in 50 mM Tris, pH 8.0, which results in >95% cleavage of β-casein, as revealed by SDS-PAGE.

Species

Human

Source

E. coli

Tag

C-His

Accession

O43464 (A134-E458)

Gene ID
Molecular Construction
N-term
HTRA2 (A134-E458)
Accession # O43464
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Serine protease HTRA2; Serine proteinase OMI; OMI; PRSS25
AA Sequence

AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE

Molecular Weight

Approximately 36.5 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.3M NaCl, 1 mM DTT, 20% glycerol, pH 7.8.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HTRA2/OMI Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HTRA2/OMI Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HTRA2/OMI Protein, Human (His)
Cat. No.:
HY-P74876
Quantity:
MCE Japan Authorized Agent: