Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris)
Hydrophobin-2/HFB2 protein critically imparts spores with hydrophobicity, enhancing their resilience and protective functions. This hydrophobic character, crucial for spore survival, improves resistance to moisture and shields against environmental threats. The significance of Hydrophobin-2/HFB2 in biological strategies is underscored by its role in ensuring the durability and viability of spores in various ecological conditions. Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris) is the recombinant Hydrophobin-2/HFB2 protein, expressed by P. pastoris , with tag free.
- Species: Others
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Hydrophobin-2/HFB2 protein critically imparts spores with hydrophobicity, enhancing their resilience and protective functions. This hydrophobic character, crucial for spore survival, improves resistance to moisture and shields against environmental threats. The significance of Hydrophobin-2/HFB2 in biological strategies is underscored by its role in ensuring the durability and viability of spores in various ecological conditions. Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris) is the recombinant Hydrophobin-2/HFB2 protein, expressed by P. pastoris , with tag free.
Background
Hydrophobin-2/HFB2 protein plays a critical role in conferring spore hydrophobicity and providing protective functions. This protein is responsible for imparting a hydrophobic character to spores, a feature essential for their survival and resilience in various environmental conditions. By contributing to spore hydrophobicity, Hydrophobin-2/HFB2 not only enhances the spores' resistance to moisture but also safeguards them from potential threats. The protective function of this protein underscores its significance in the biological strategies employed by organisms, ensuring the durability and viability of spores in diverse ecological settings.
Technical Parameters
-
Species Others
-
Source P. pastoris
-
Tag Tag Free
-
Accession
P79073 (A16-F86)
-
Gene ID18482765 [NCBI]
-
Molecular Construction
-
N-term
-
HFB2 (A16-F86)
Accession # P7973 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Class II hydrophobin 2; Hydrophobin II; HFBII; hfb2
-
AA Sequence
AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
-
Predicted Molecular Mass
23.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
