ICAM-1/CD54 Protein, Human (HEK293)

The ICAM-1/CD54 protein plays a crucial role in cell interactions, acting as a ligand for the leukocyte adhesion protein LFA-1. It promotes leukocyte transendothelial migration by promoting the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM-1/CD54 Protein, Human (HEK293) is the recombinant human-derived ICAM-1/CD54 protein, expressed by HEK293 , with tag free.

ICAM-1/CD54 protein emerges as a crucial player in cellular interactions, functioning as a ligand for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). Particularly notable is its role during leukocyte trans-endothelial migration, where engagement with ICAM-1 promotes the assembly of endothelial apical cups through the activation of ARHGEF26/SGEF and RHOG. In the context of microbial infection, ICAM-1 also acts as a receptor for major receptor group rhinovirus A-B capsid proteins, highlighting its versatile involvement in both immune responses and pathogen recognition. This dual functionality underscores the significance of ICAM-1 in mediating diverse cellular processes critical for immune regulation and host defense.

Human

HEK293

Tag Free

P05362 (Q28-E480)

3383  [NCBI]

Extracellular Domain

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Approximately 71.3 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.