IGF2 Protein, Human (HEK293, hFc)

The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. IGF2 Protein, Human (HEK293, hFc) is the recombinant human-derived IGF2 protein, expressed by HEK293, with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. IGF2 Protein, Human (HEK293, hFc) is the recombinant human-derived IGF2 protein, expressed by HEK293, with N-hFc labeled tag.

Background

The IGF2 protein, a member of the insulin-like growth factor family, plays a pivotal role in promoting growth and influencing fetoplacental development, particularly as a major fetal growth hormone in mammals. It is regulated by placental lactogen and contributes to tissue differentiation. In adults, IGF2 is involved in glucose metabolism in adipose tissue, skeletal muscle, and the liver. Acting as a ligand for integrin, it facilitates IGF2 signaling and positively regulates the function of the myogenic transcription factor MYOD1, controlling muscle terminal differentiation. Additionally, IGF2 inhibits myoblast differentiation and modulates metabolism by increasing mitochondrial respiration rates. Moreover, in glucose-mediated co-secretion with insulin, IGF2's counterpart, preptin, acts as a physiological amplifier of glucose-mediated insulin secretion. Notably, IGF2 exhibits osteogenic properties, enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • IGF2 (A25-E91)
      Accession # P01344-1
    • C-term
  • Protein Length

    Full Length of IGF2 Chain

  • Synonyms

    IGF2; Insulin-Like Growth Factor 2 (Somatomedin A); Prev. C11orf43; Insulin-Like Growth Factor Type 2; Insulin-Like Growth Factor 2; Somatomedin A; IGF-II; Somatomedin-A; Insulin-Like Growth Factor II; PP9974; T3M-11-Derived Growth Factor; IGF-2; FLJ44734

  • AA Sequence

    AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

  • Predicted Molecular Mass

    34.4 kDa

  • Molecular Weight

    Approximately 35-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00