IGFBP-7 Protein, Human (Biotinylated, HEK293, His-Avi)
IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IGFBP-7 Protein, with relatively low IGF-I and IGF-II affinity, stimulates prostacyclin (PGI2) production and enhances cell adhesion. The significance of its interaction with VPS24/CHMP3 remains uncertain and warrants further investigation. IGFBP-7, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IGFBP-7 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
Background
IGFBP-7 protein exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. It is worth noting that the significance of its interaction with VPS24/CHMP3 remains uncertain and requires further investigation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-His
-
Accession
Q16270-1 (S27-L282)
-
Gene ID3490
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Synonyms
IGFBP7; IGFBP-RP1; Insulin Like Growth Factor Binding Protein 7; IBP-7; IGFBP-7; TAF; MAC25; Insulin-Like Growth Factor Binding Protein 7; PSF; MAC25 Protein; FSTL2; Angiomodulin; Insulin-Like Growth Factor-Binding Protein 7; IGFBP-7v; Prostacyclin-Stimul
-
AA Sequence
SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
-
Predicted Molecular Mass
29.8 kDa
-
Molecular Weight
Approximately 34-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
