IGFL1 Protein, Human (HEK293, hFc)

IGFL1 Protein, a probable ligand for the IGFLR1 receptor, mediates cellular responses through receptor binding. As a homodimer with disulfide linkages, IGFL1's structural arrangement suggests involvement in specific signaling events. Its homodimeric nature underscores capacity for complex interactions, emphasizing potential significance in cellular communication. Further investigations into IGFL1-IGFLR1 interaction will provide valuable insights into the functional roles of this ligand-receptor pair in signaling pathways. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293, with C-hFc labeled tag. The total length of IGFL1 Protein, Human (HEK293, hFc) is 86 a.a., with molecular weight of 38.7 kDa.

The IGFL1 protein is identified as a probable ligand for the IGFLR1 cell membrane receptor, indicating its role in mediating cellular responses through receptor binding. Existing as a homodimer with disulfide linkages, IGFL1 showcases a structural arrangement that suggests its potential involvement in specific signaling events upon binding to its cognate receptor. The homodimeric nature of IGFL1 underlines its capacity for complex interactions, emphasizing its potential significance in cellular communication and signaling pathways mediated by the IGFLR1 receptor. Further investigations into the precise mechanisms and downstream effects of the IGFL1-IGFLR1 interaction will provide valuable insights into the functional roles of this ligand-receptor pair.

Human

HEK293

C-hFc

Q6UW32 (A25-S110)

374918  [NCBI]

APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

38.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.