IGFL1 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The IGFL1 protein is a possible ligand of the IGFLR1 receptor and mediates cellular responses through receptor binding. As a homodimer with disulfide bonds, the structural arrangement of IGFL1 suggests involvement in specific signaling events. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IGFL1 protein is a possible ligand of the IGFLR1 receptor and mediates cellular responses through receptor binding. As a homodimer with disulfide bonds, the structural arrangement of IGFL1 suggests involvement in specific signaling events. IGFL1 Protein, Human (HEK293, hFc) is the recombinant human-derived IGFL1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The IGFL1 protein is identified as a probable ligand for the IGFLR1 cell membrane receptor, indicating its role in mediating cellular responses through receptor binding. Existing as a homodimer with disulfide linkages, IGFL1 showcases a structural arrangement that suggests its potential involvement in specific signaling events upon binding to its cognate receptor. The homodimeric nature of IGFL1 underlines its capacity for complex interactions, emphasizing its potential significance in cellular communication and signaling pathways mediated by the IGFLR1 receptor. Further investigations into the precise mechanisms and downstream effects of the IGFL1-IGFLR1 interaction will provide valuable insights into the functional roles of this ligand-receptor pair.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 5 μg/mL can bind IGFL1 Protein, Human (HEK293, hFc), the EC50 is ≤ 85 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q6UW32 (A25-S110)
-
Molecular Construction
-
N-term
-
IGFL1 (A25-S110)
Accession # Q6UW32 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IGFL1; Insulin Growth Factor-Like Family Member 1; IGF Like Family Member 1; APRG644; UNQ644
-
AA Sequence
APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
-
Predicted Molecular Mass
38.7 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
