1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 beta
  6. IL-1 beta Protein, Human (HEK293, hFc)

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (HEK293, hFc) is the recombinant human-derived IL-1 beta protein, expressed by HEK293, with N-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
20 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Obtener un presupuesto  
Synthetic products have potential research and development risk.

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (HEK293, hFc) is the recombinant human-derived IL-1 beta protein, expressed by HEK293, with N-hFc labeled tag.

Background

IL-1 beta Protein stands as a potent pro-inflammatory cytokine, recognized for its diverse roles in orchestrating immune responses. Originally identified as a major endogenous pyrogen, IL-1 beta induces a cascade of inflammatory events, including prostaglandin synthesis, neutrophil influx and activation, T-cell and B-cell activation, cytokine production, as well as fibroblast proliferation and collagen production. It plays a pivotal role in immune cell differentiation, promoting Th17 differentiation of T-cells and synergizing with IL-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Additionally, IL-1 beta contributes to angiogenesis by inducing VEGF production, working synergistically with TNF and IL-6. Notably, it plays a key role in transducing inflammation downstream of pyroptosis, being specifically released into the extracellular milieu through the gasdermin-D (GSDMD) pore. In the context of microbial infection, IL-1 beta acts as a sensor of S. pyogenes infection in the skin, undergoing cleavage and activation by the pyogenes SpeB protease, leading to an inflammatory response that curtails bacterial growth during invasive skin infection. However, the cleavage of IL-1 beta by SpeB has a dual role, promoting streptococcal infection of the nasopharynx by disrupting colonization resistance mediated by the microbiota.

Actividad biológica

Immobilized Human IL-1 RII, His Tag at 5 μg/mL (100 μL/well) can bind Human IL-1 beta, Fc Tag with a linear range of 250-300 ng/mL.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P01584 (A117-S269)

Gene ID

3553

Molecular Construction
N-term
hFc
IL-1β (A117-S269)
Accession # P01584
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-1 beta; IL-1 beta; IL1F2; IL1B; IL-1BETA; IL1F2; IL-1β; IL-1 beta; IL-1B ; Interleukin-1 β; IL-1 β; IL-1β; IL-1 β
AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Predicted Molecular Mass
43.8 kDa
Peso molecular

Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-1 beta Protein, Human (HEK293, hFc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-1 beta Protein, Human (HEK293, hFc)
Cat. No.:
HY-P704378
Cantidad:
MCE Japan Authorized Agent: